Brand: | Abnova |
Reference: | H00000535-A01 |
Product name: | ATP6V0A1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ATP6V0A1. |
Gene id: | 535 |
Gene name: | ATP6V0A1 |
Gene alias: | ATP6N1|ATP6N1A|DKFZp781J1951|Stv1|VPP1|Vph1|a1 |
Gene description: | ATPase, H+ transporting, lysosomal V0 subunit a1 |
Genbank accession: | NM_005177 |
Immunogen: | ATP6V0A1 (NP_005168, 212 a.a. ~ 298 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | GDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVR |
Protein accession: | NP_005168 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.68 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | An animal homolog of plant Mep/Amt transporters promotes ammonia excretion by the anal papillae of the disease vector mosquito, Aedes aegypti.Chasiotis H, Ionescu A, Misyura L, Bui P, Fazio K, Wang J, Patrick M, Weihrauch D, Donini A. J Exp Biol.?2016 May 1;219(Pt 9):1346-55. |