Cart 119 Product Products 39 601,72 € (empty)
-
1 x CD10...259,07 € -
1 x Nox3...259,07 € -
1 x Op18...259,07 € -
1 x Angptl4...259,07 € -
1 x Raf-B...259,07 € -
-
-
1 x Caspase 9...259,07 € -
1 x Neurotrimi...259,07 € -
1 x APC1...259,07 € -
1 x RERG...259,07 € -
-
-
-
1 x CD58...259,07 € -
1 x HSP10...259,07 € -
1 x HCN2...259,07 € -
-
-
-
1 x CHP2...259,07 € -
1 x Exo1...259,07 € -
1 x MRP-S27...259,07 € -
1 x ACBP...259,07 € -
1 x GROγ...259,07 € -
1 x Dysferlin...259,07 € -
-
-
-
1 x NFκB-p65...259,07 € -
1 x Prothrombi...259,07 € -
1 x CyPA...259,07 € -
1 x HPA1...259,07 € -
1 x DGK-δ...259,07 € -
1 x mTOR...259,07 € -
1 x NY-CO-9...259,07 € -
1 x Cystatin...259,07 € -
1 x Cubilin...259,07 € -
-
-
1 x Histone...259,07 € -
-
1 x NOS1...259,07 € -
1 x PSG1...259,07 € -
1 x Cystatin...259,07 € -
1 x Shb...259,07 € -
1 x GABA T-3...259,07 € -
1 x SMC1...259,07 € -
1 x Cdc7...259,07 € -
1 x C7...259,07 € -
1 x GGT1...259,07 € -
1 x AR-β2...259,07 € -
1 x EWS...259,07 € -
1 x Op18...259,07 € -
1 x JTB...259,07 € -
1 x Cystatin...259,07 € -
-
-
-
1 x NOM1...259,07 € -
1 x ACAD-10...259,07 € -
-
1 x CD59...259,07 € -
1 x MyoD...259,07 € -
1 x Nrf2...259,07 € -
1 x GSK3β...259,07 € -
1 x C32...259,07 € -
-
-
-
1 x SNAP 23...259,07 € -
1 x CD45...259,07 € -
1 x Musculin...259,07 € -
1 x NOS2...259,07 € -
1 x TANK...259,07 € -
1 x SRY...259,07 € -
-
-
-
-
-
1 x DHS...259,07 € -
1 x Elf-5...259,07 € -
1 x NFRκB...259,07 € -
1 x APC1...259,07 € -
-
-
-
-
-
1 x CD1C...259,07 € -
1 x NTE...259,07 € -
1 x SRF...259,07 € -
-
-
1 x CD20...259,07 € -
1 x ERCC1...259,07 € -
1 x NAB2...259,07 € -
1 x p47-phox...259,07 € -
1 x HER2...259,07 € -
1 x Elk-1...259,07 € -
1 x NUB1...259,07 € -
1 x OCRL...259,07 € -
1 x MCT8...259,07 € -
1 x Unc18-1...259,07 € -
1 x ORC1...259,07 € -
1 x SP-A...259,07 € -
1 x TAUT...259,07 € -
1 x Smo...259,07 € -
-
1 x EF-2...259,07 € -
1 x Transferri...259,07 € -
1 x ZSCAN16...259,07 € -
-
-
-
-
1 x NFκB-p65...259,07 € -
No products
To be determined Shipping
39 601,72 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 119 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 39 601,72 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 39 601,72 €
Data sheet of ATP6V0B purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about ATP6V0B purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00000533-D01P |
| Product name: | ATP6V0B purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human ATP6V0B protein. |
| Gene id: | 533 |
| Gene name: | ATP6V0B |
| Gene alias: | ATP6F|HATPL|VMA16 |
| Gene description: | ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b |
| Genbank accession: | NM_004047.3 |
| Immunogen: | ATP6V0B (NP_004038.1, 1 a.a. ~ 205 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTGLALLYSGVFVAFWACALAVGVCYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD |
| Protein accession: | NP_004038.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ATP6V0B expression in transfected 293T cell line (H00000533-T04) by ATP6V0B MaxPab polyclonal antibody. Lane 1: ATP6V0B transfected lysate(21.40 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |