Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ATP6V1E1 monoclonal antibody (M02), clone 4E11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about ATP6V1E1 monoclonal antibody (M02), clone 4E11
| Brand: | Abnova |
| Reference: | H00000529-M02 |
| Product name: | ATP6V1E1 monoclonal antibody (M02), clone 4E11 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ATP6V1E1. |
| Clone: | 4E11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 529 |
| Gene name: | ATP6V1E1 |
| Gene alias: | ATP6E|ATP6E2|ATP6V1E|P31|Vma4 |
| Gene description: | ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 |
| Genbank accession: | BC004443 |
| Immunogen: | ATP6V1E1 (AAH04443, 1 a.a. ~ 226 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD |
| Protein accession: | AAH04443 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (50.6 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ATP6V1E1 expression in transfected 293T cell line by ATP6V1E1 monoclonal antibody (M02), clone 4E11. Lane 1: ATP6V1E1 transfected lysate(26.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Atg5 Disassociates the V1V0-ATPase to Promote Exosome Production and Tumor Metastasis Independent of Canonical Macroautophagy.Guo H, Chitiprolu M, Roncevic L, Javalet C, Hemming FJ, Trung MT, Meng L, Latreille E, Tanese de Souza C, McCulloch D, Baldwin RM, Auer R, Cote J, Russell RC, Sadoul R, Gibbings D. Dev Cell. 2017 Dec 18;43(6):716-730.e7. |