Cart 2 Product Products 277,98 € (empty)
No products
To be determined Shipping
277,98 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 277,98 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 277,98 €
Data sheet of ATP6V1E1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Ti,WB-Tr |
More info about ATP6V1E1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00000529-D01P |
| Product name: | ATP6V1E1 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human ATP6V1E1 protein. |
| Gene id: | 529 |
| Gene name: | ATP6V1E1 |
| Gene alias: | ATP6E|ATP6E2|ATP6V1E|P31|Vma4 |
| Gene description: | ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 |
| Genbank accession: | NM_001696.3 |
| Immunogen: | ATP6V1E1 (NP_001687.1, 1 a.a. ~ 226 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD |
| Protein accession: | NP_001687.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Western Blot analysis of ATP6V1E1 expression in transfected 293T cell line (H00000529-T04) by ATP6V1E1 MaxPab polyclonal antibody. Lane 1: ATP6V1E1 transfected lysate(26.10 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |