Brand: | Abnova |
Reference: | H00000525-M02 |
Product name: | ATP6V1B1 monoclonal antibody (M02), clone 3G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ATP6V1B1. |
Clone: | 3G11 |
Isotype: | IgG2b Kappa |
Gene id: | 525 |
Gene name: | ATP6V1B1 |
Gene alias: | ATP6B1|MGC32642|RTA1B|VATB|VMA2|VPP3 |
Gene description: | ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1 |
Genbank accession: | NM_001692 |
Immunogen: | ATP6V1B1 (NP_001683.2, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIVHFTLPDGTQ |
Protein accession: | NP_001683.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ATP6V1B1 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |