ATP5J monoclonal antibody (M02), clone 2F4 View larger

ATP5J monoclonal antibody (M02), clone 2F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP5J monoclonal antibody (M02), clone 2F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ATP5J monoclonal antibody (M02), clone 2F4

Brand: Abnova
Reference: H00000522-M02
Product name: ATP5J monoclonal antibody (M02), clone 2F4
Product description: Mouse monoclonal antibody raised against a full-length recombinant ATP5J.
Clone: 2F4
Isotype: IgG2a Kappa
Gene id: 522
Gene name: ATP5J
Gene alias: ATP5|ATP5A|ATPM|CF6|F6
Gene description: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6
Genbank accession: BC001178
Immunogen: ATP5J (AAH01178, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA
Protein accession: AAH01178
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000522-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000522-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ATP5J is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ATP5J monoclonal antibody (M02), clone 2F4 now

Add to cart