ATP5J polyclonal antibody (A01) View larger

ATP5J polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP5J polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ATP5J polyclonal antibody (A01)

Brand: Abnova
Reference: H00000522-A01
Product name: ATP5J polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ATP5J.
Gene id: 522
Gene name: ATP5J
Gene alias: ATP5|ATP5A|ATPM|CF6|F6
Gene description: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6
Genbank accession: NM_001003696
Immunogen: ATP5J (NP_001003696, 9 a.a. ~ 108 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: FSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA
Protein accession: NP_001003696
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000522-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ATP5J polyclonal antibody (A01) now

Add to cart