H00000516-M01_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00000516-M01 |
Product name: | ATP5G1 monoclonal antibody (M01), clone 1A12 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ATP5G1. |
Clone: | 1A12 |
Isotype: | IgG1 Kappa |
Gene id: | 516 |
Gene name: | ATP5G1 |
Gene alias: | ATP5A|ATP5G |
Gene description: | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) |
Genbank accession: | BC004963 |
Immunogen: | ATP5G1 (AAH04963, 18 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TRGLIRPVSASFLSSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM |
Protein accession: | AAH04963 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.83 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged ATP5G1 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Neuronal cell surface ATP synthase mediates synthesis of extracellular ATP and regulation of intracellular pH.Xing SL, Yan J, Yu ZH, Zhu CQ. Cell Biol Int. 2010 Jul 14. [Epub ahead of print] |