ATP5F1 purified MaxPab mouse polyclonal antibody (B02P) View larger

ATP5F1 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP5F1 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ATP5F1 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00000515-B02P
Product name: ATP5F1 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human ATP5F1 protein.
Gene id: 515
Gene name: ATP5F1
Gene alias: MGC24431|PIG47
Gene description: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1
Genbank accession: NM_001688.4
Immunogen: ATP5F1 (NP_001679.2, 1 a.a. ~ 256 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM
Protein accession: NP_001679.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000515-B02P-13-15-1.jpg
Application image note: Western Blot analysis of ATP5F1 expression in transfected 293T cell line (H00000515-T02) by ATP5F1 MaxPab polyclonal antibody.

Lane 1: ATP5F1 transfected lysate(28.16 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ATP5F1 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart