ATP5F1 MaxPab mouse polyclonal antibody (B01) View larger

ATP5F1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP5F1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ATP5F1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00000515-B01
Product name: ATP5F1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human ATP5F1 protein.
Gene id: 515
Gene name: ATP5F1
Gene alias: MGC24431|PIG47
Gene description: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1
Genbank accession: BC005366.1
Immunogen: ATP5F1 (AAH05366.1, 1 a.a. ~ 256 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM
Protein accession: AAH05366.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000515-B01-13-15-1.jpg
Application image note: Western Blot analysis of ATP5F1 expression in transfected 293T cell line (H00003821-T02) by ATP5F1 MaxPab polyclonal antibody.

Lane 1: ATP5F1 transfected lysate(28.27 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ATP5F1 MaxPab mouse polyclonal antibody (B01) now

Add to cart