Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ATP5E monoclonal antibody (M01), clone 2F3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,ELISA,WB-Re |
More info about ATP5E monoclonal antibody (M01), clone 2F3
| Brand: | Abnova |
| Reference: | H00000514-M01 |
| Product name: | ATP5E monoclonal antibody (M01), clone 2F3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ATP5E. |
| Clone: | 2F3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 514 |
| Gene name: | ATP5E |
| Gene alias: | ATPE|MGC104243 |
| Gene description: | ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit |
| Genbank accession: | BC001690 |
| Immunogen: | ATP5E (AAH01690, 1 a.a. ~ 51 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE |
| Protein accession: | AAH01690 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.35 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ATP5E on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Knockdown of F(1) epsilon subunit decreases mitochondrial content of ATP synthase and leads to accumulation of subunit c.Havlickova V, Kaplanova V, Nuskova H, Drahota Z, Houstek J. Biochim Biophys Acta. 2009 Dec 21. [Epub ahead of print] |