Brand: | Abnova |
Reference: | H00000493-M07 |
Product name: | ATP2B4 monoclonal antibody (M07), clone 2G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ATP2B4. |
Clone: | 2G8 |
Isotype: | IgG1 Kappa |
Gene id: | 493 |
Gene name: | ATP2B4 |
Gene alias: | ATP2B2|DKFZp686G08106|DKFZp686M088|MXRA1|PMCA4|PMCA4b|PMCA4x |
Gene description: | ATPase, Ca++ transporting, plasma membrane 4 |
Genbank accession: | NM_001684 |
Immunogen: | ATP2B4 (NP_001675, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKT |
Protein accession: | NP_001675 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ATP2B4 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |