ATP2B1 monoclonal antibody (M01), clone 3E2 View larger

ATP2B1 monoclonal antibody (M01), clone 3E2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP2B1 monoclonal antibody (M01), clone 3E2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ATP2B1 monoclonal antibody (M01), clone 3E2

Brand: Abnova
Reference: H00000490-M01
Product name: ATP2B1 monoclonal antibody (M01), clone 3E2
Product description: Mouse monoclonal antibody raised against a partial recombinant ATP2B1.
Clone: 3E2
Isotype: IgG2a Kappa
Gene id: 490
Gene name: ATP2B1
Gene alias: PMCA1|PMCA1kb
Gene description: ATPase, Ca++ transporting, plasma membrane 1
Genbank accession: NM_001682
Immunogen: ATP2B1 (NP_001673, 1 a.a. ~ 97 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKT
Protein accession: NP_001673
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000490-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000490-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ATP2B1 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ATP2B1 monoclonal antibody (M01), clone 3E2 now

Add to cart