Brand: | Abnova |
Reference: | H00000487-M05 |
Product name: | ATP2A1 monoclonal antibody (M05), clone 4B8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ATP2A1. |
Clone: | 4B8 |
Isotype: | IgG3 Kappa |
Gene id: | 487 |
Gene name: | ATP2A1 |
Gene alias: | ATP2A|SERCA1 |
Gene description: | ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 |
Genbank accession: | NM_173201 |
Immunogen: | ATP2A1 (NP_775293, 522 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ |
Protein accession: | NP_775293 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to ATP2A1 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,ELISA,WB-Re |
Shipping condition: | Dry Ice |