FXYD2 monoclonal antibody (M01), clone 1C3-B3 View larger

FXYD2 monoclonal antibody (M01), clone 1C3-B3

H00000486-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FXYD2 monoclonal antibody (M01), clone 1C3-B3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about FXYD2 monoclonal antibody (M01), clone 1C3-B3

Brand: Abnova
Reference: H00000486-M01
Product name: FXYD2 monoclonal antibody (M01), clone 1C3-B3
Product description: Mouse monoclonal antibody raised against a full length recombinant FXYD2.
Clone: 1C3-B3
Isotype: IgG2b kappa
Gene id: 486
Gene name: FXYD2
Gene alias: ATP1G1|HOMG2|MGC12372
Gene description: FXYD domain containing ion transport regulator 2
Genbank accession: BC005302
Immunogen: FXYD2 (AAH05302.1, 1 a.a. ~ 64 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP
Protein accession: AAH05302.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000486-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000486-M01-3-6-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to FXYD2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: A genomic-based approach identifies FXYD domain containing ion transport regulator 2 (FXYD2)gammaa as a pancreatic beta cell-specific biomarker.Flamez D, Roland I, Berton A, Kutlu B, Dufrane D, Beckers MC, De Waele E, Rooman I, Bouwens L, Clark A, Lonneux M, Jamar JF, Goldman S, Marechal D, Goodman N, Gianello P, Van Huffel C, Salmon I, Eizirik DL.
Diabetologia. 2010 Apr 9. [Epub ahead of print]

Reviews

Buy FXYD2 monoclonal antibody (M01), clone 1C3-B3 now

Add to cart