ATP1B2 monoclonal antibody (M04), clone 4E3 View larger

ATP1B2 monoclonal antibody (M04), clone 4E3

H00000482-M04_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP1B2 monoclonal antibody (M04), clone 4E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ATP1B2 monoclonal antibody (M04), clone 4E3

Brand: Abnova
Reference: H00000482-M04
Product name: ATP1B2 monoclonal antibody (M04), clone 4E3
Product description: Mouse monoclonal antibody raised against a partial recombinant ATP1B2.
Clone: 4E3
Isotype: IgG2a Kappa
Gene id: 482
Gene name: ATP1B2
Gene alias: AMOG
Gene description: ATPase, Na+/K+ transporting, beta 2 polypeptide
Genbank accession: NM_001678
Immunogen: ATP1B2 (NP_001669.3, 84 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGAN
Protein accession: NP_001669.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000482-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000482-M04-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged ATP1B2 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ATP1B2 monoclonal antibody (M04), clone 4E3 now

Add to cart