ATOX1 monoclonal antibody (M06), clone 3F7 View larger

ATOX1 monoclonal antibody (M06), clone 3F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATOX1 monoclonal antibody (M06), clone 3F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ATOX1 monoclonal antibody (M06), clone 3F7

Brand: Abnova
Reference: H00000475-M06
Product name: ATOX1 monoclonal antibody (M06), clone 3F7
Product description: Mouse monoclonal antibody raised against a partial recombinant ATOX1.
Clone: 3F7
Isotype: IgG2a Kappa
Gene id: 475
Gene name: ATOX1
Gene alias: ATX1|HAH1|MGC138453|MGC138455
Gene description: ATX1 antioxidant protein 1 homolog (yeast)
Genbank accession: NM_004045
Immunogen: ATOX1 (NP_004036, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Protein accession: NP_004036
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000475-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.22 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000475-M06-1-18-1.jpg
Application image note: ATOX1 monoclonal antibody (M06), clone 3F7. Western Blot analysis of ATOX1 expression in COLO 320 HSR ( Cat # L020V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ATOX1 monoclonal antibody (M06), clone 3F7 now

Add to cart