Brand: | Abnova |
Reference: | H00000475-M02 |
Product name: | ATOX1 monoclonal antibody (M02), clone 3A2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ATOX1. |
Clone: | 3A2 |
Isotype: | IgG2a Kappa |
Gene id: | 475 |
Gene name: | ATOX1 |
Gene alias: | ATX1|HAH1|MGC138453|MGC138455 |
Gene description: | ATX1 antioxidant protein 1 homolog (yeast) |
Genbank accession: | NM_004045 |
Immunogen: | ATOX1 (NP_004036, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE |
Protein accession: | NP_004036 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.22 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ATOX1 monoclonal antibody (M02), clone 3A2. Western Blot analysis of ATOX1 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,WB-Ti,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |