ATOH1 monoclonal antibody (M13), clone 2B1 View larger

ATOH1 monoclonal antibody (M13), clone 2B1

H00000474-M13_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATOH1 monoclonal antibody (M13), clone 2B1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ATOH1 monoclonal antibody (M13), clone 2B1

Brand: Abnova
Reference: H00000474-M13
Product name: ATOH1 monoclonal antibody (M13), clone 2B1
Product description: Mouse monoclonal antibody raised against a full length recombinant ATOH1.
Clone: 2B1
Isotype: IgG2a Kappa
Gene id: 474
Gene name: ATOH1
Gene alias: ATH1|HATH1|MATH-1|bHLHa14
Gene description: atonal homolog 1 (Drosophila)
Genbank accession: NM_005172
Immunogen: ATOH1 (NP_005163, 1 a.a. ~ 130 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCK
Protein accession: NP_005163
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000474-M13-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (40.3 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ATOH1 monoclonal antibody (M13), clone 2B1 now

Add to cart