Brand: | Abnova |
Reference: | H00000474-M07 |
Product name: | ATOH1 monoclonal antibody (M07), clone 2G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ATOH1. |
Clone: | 2G8 |
Isotype: | IgG2a Kappa |
Gene id: | 474 |
Gene name: | ATOH1 |
Gene alias: | ATH1|HATH1|MATH-1|bHLHa14 |
Gene description: | atonal homolog 1 (Drosophila) |
Genbank accession: | NM_005172 |
Immunogen: | ATOH1 (NP_005163.1, 266 a.a. ~ 354 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS |
Protein accession: | NP_005163.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to ATOH1 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |