ATOH1 monoclonal antibody (M05), clone 3E2 View larger

ATOH1 monoclonal antibody (M05), clone 3E2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATOH1 monoclonal antibody (M05), clone 3E2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about ATOH1 monoclonal antibody (M05), clone 3E2

Brand: Abnova
Reference: H00000474-M05
Product name: ATOH1 monoclonal antibody (M05), clone 3E2
Product description: Mouse monoclonal antibody raised against a partial recombinant ATOH1.
Clone: 3E2
Isotype: IgG2a Kappa
Gene id: 474
Gene name: ATOH1
Gene alias: ATH1|HATH1|MATH-1|bHLHa14
Gene description: atonal homolog 1 (Drosophila)
Genbank accession: NM_005172
Immunogen: ATOH1 (NP_005163.1, 266 a.a. ~ 354 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS
Protein accession: NP_005163.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000474-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000474-M05-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to ATOH1 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ATOH1 monoclonal antibody (M05), clone 3E2 now

Add to cart