ATOH1 purified MaxPab mouse polyclonal antibody (B01P) View larger

ATOH1 purified MaxPab mouse polyclonal antibody (B01P)

H00000474-B01P_50ug

New product

395,00 € tax excl.

50 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATOH1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ATOH1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00000474-B01P
Product name: ATOH1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ATOH1 protein.
Gene id: 474
Gene name: ATOH1
Gene alias: ATH1|HATH1|MATH-1|bHLHa14
Gene description: atonal homolog 1 (Drosophila)
Genbank accession: NM_005172.1
Immunogen: ATOH1 (NP_005163.1, 1 a.a. ~ 354 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS
Protein accession: NP_005163.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000474-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ATOH1 expression in transfected 293T cell line (H00000474-T01) by ATOH1 MaxPab polyclonal antibody.

Lane 1: ATOH1 transfected lysate(38.94 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ATOH1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart