ATF3 (Human) Recombinant Protein (P01) View larger

ATF3 (Human) Recombinant Protein (P01)

New product

279,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATF3 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about ATF3 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00000467-P01
Product name: ATF3 (Human) Recombinant Protein (P01)
Product description: Human ATF3 full-length ORF ( AAH06322, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 467
Gene name: ATF3
Gene alias: -
Gene description: activating transcription factor 3
Genbank accession: BC006322
Immunogen sequence/protein sequence: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
Protein accession: AAH06322
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00000467-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: SUMOylation of ATF3 alters its transcriptional activity on regulation of TP53 gene.Wang CM, Brennan VC, Gutierrez NM, Wang X, Wang L, Yang WH.
J Cell Biochem. 2012 Sep 18. doi: 10.1002/jcb.24396. [Epub ahead of print]

Reviews

Buy ATF3 (Human) Recombinant Protein (P01) now

Add to cart