Brand: | Abnova |
Reference: | H00000467-M07 |
Product name: | ATF3 monoclonal antibody (M07), clone 6G11 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ATF3. |
Clone: | 6G11 |
Isotype: | IgG3 Kappa |
Gene id: | 467 |
Gene name: | ATF3 |
Gene alias: | - |
Gene description: | activating transcription factor 3 |
Genbank accession: | BC006322 |
Immunogen: | ATF3 (AAH06322, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS |
Protein accession: | AAH06322 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (45.65 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ATF3 monoclonal antibody (M07), clone 6G11 Western Blot analysis of ATF3 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |