ATF3 monoclonal antibody (M02), clone 8D8 View larger

ATF3 monoclonal antibody (M02), clone 8D8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATF3 monoclonal antibody (M02), clone 8D8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ATF3 monoclonal antibody (M02), clone 8D8

Brand: Abnova
Reference: H00000467-M02
Product name: ATF3 monoclonal antibody (M02), clone 8D8
Product description: Mouse monoclonal antibody raised against a full length recombinant ATF3.
Clone: 8D8
Isotype: IgG1 Kappa
Gene id: 467
Gene name: ATF3
Gene alias: -
Gene description: activating transcription factor 3
Genbank accession: BC006322
Immunogen: ATF3 (AAH06322, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
Protein accession: AAH06322
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000467-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (45.65 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000467-M02-1-25-1.jpg
Application image note: ATF3 monoclonal antibody (M02), clone 8D8 Western Blot analysis of ATF3 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ATF3 monoclonal antibody (M02), clone 8D8 now

Add to cart