Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ATF3 monoclonal antibody (M01), clone 6B8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about ATF3 monoclonal antibody (M01), clone 6B8
| Brand: | Abnova |
| Reference: | H00000467-M01 |
| Product name: | ATF3 monoclonal antibody (M01), clone 6B8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ATF3. |
| Clone: | 6B8 |
| Isotype: | IgG3 Kappa |
| Gene id: | 467 |
| Gene name: | ATF3 |
| Gene alias: | - |
| Gene description: | activating transcription factor 3 |
| Genbank accession: | BC006322 |
| Immunogen: | ATF3 (AAH06322, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS |
| Protein accession: | AAH06322 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.65 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of ATF3 over-expressed 293 cell line, cotransfected with ATF3 Validated Chimera RNAi ( Cat # H00000467-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ATF3 monoclonal antibody (M01), clone 6B8 (Cat # H00000467-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Energy restriction-mimetic agents induce apoptosis in prostate cancer cells, in part, through epigenetic activation of KLF6 tumor suppressor gene expression.Chen CH, Huang PH, Chu PC, Chen MC, Chou CC, Wang D, Kulp SK, Teng CM, Wang Q, Chen CS. J Biol Chem. 2011 Feb 3. [Epub ahead of print] |