Brand: | Abnova |
Reference: | H00000466-M01A |
Product name: | ATF1 monoclonal antibody (M01A), clone 6G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ATF1. |
Clone: | 6G10 |
Isotype: | IgM Kappa |
Gene id: | 466 |
Gene name: | ATF1 |
Gene alias: | EWS-ATF1|FUS/ATF-1|TREB36 |
Gene description: | activating transcription factor 1 |
Genbank accession: | NM_005171 |
Immunogen: | ATF1 (NP_005162, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ASPGTDGVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRL |
Protein accession: | NP_005162 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |