ASPH monoclonal antibody (M09), clone 3G5 View larger

ASPH monoclonal antibody (M09), clone 3G5

H00000444-M09_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ASPH monoclonal antibody (M09), clone 3G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ASPH monoclonal antibody (M09), clone 3G5

Brand: Abnova
Reference: H00000444-M09
Product name: ASPH monoclonal antibody (M09), clone 3G5
Product description: Mouse monoclonal antibody raised against a partial recombinant ASPH.
Clone: 3G5
Isotype: IgG2a Kappa
Gene id: 444
Gene name: ASPH
Gene alias: BAH|CASQ2BP1|HAAH|JCTN|junctin
Gene description: aspartate beta-hydroxylase
Genbank accession: NM_032468
Immunogen: ASPH (NP_115857, 161 a.a. ~ 270 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PTGEPQQEDDEFLMATDVDDRFETLEPEVSHEETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPE
Protein accession: NP_115857
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000444-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000444-M09-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ASPH is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ASPH monoclonal antibody (M09), clone 3G5 now

Add to cart