Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ASPH MaxPab rabbit polyclonal antibody (D03)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr,IP |
More info about ASPH MaxPab rabbit polyclonal antibody (D03)
| Brand: | Abnova |
| Reference: | H00000444-D03 |
| Product name: | ASPH MaxPab rabbit polyclonal antibody (D03) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human ASPH protein. |
| Gene id: | 444 |
| Gene name: | ASPH |
| Gene alias: | BAH|CASQ2BP1|HAAH|JCTN|junctin |
| Gene description: | aspartate beta-hydroxylase |
| Genbank accession: | NM_032467.1 |
| Immunogen: | ASPH (NP_115856.1, 1 a.a. ~ 210 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEELKKEKEKPESRKESKNEERKKGKKEDVRKDKKIADADLSRKESPKGKKDREKEKVDLEKSAKTKENRKKSTNMKDVSSKMASRDKDDRKESRSSTRYAHLTKGNTQKRNG |
| Protein accession: | NP_115856.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of ASPH transfected lysate using anti-ASPH MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ASPH purified MaxPab mouse polyclonal antibody (B02P) (H00000444-B02P). |
| Applications: | WB-Tr,IP |
| Shipping condition: | Dry Ice |