ASPH purified MaxPab mouse polyclonal antibody (B02P) View larger

ASPH purified MaxPab mouse polyclonal antibody (B02P)

H00000444-B02P_50ug

New product

395,00 € tax excl.

50 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ASPH purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ASPH purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00000444-B02P
Product name: ASPH purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human ASPH protein.
Gene id: 444
Gene name: ASPH
Gene alias: BAH|CASQ2BP1|HAAH|JCTN|junctin
Gene description: aspartate beta-hydroxylase
Genbank accession: NM_032467.1
Immunogen: ASPH (NP_115856.1, 1 a.a. ~ 210 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAEDKETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEELKKEKEKPESRKESKNEERKKGKKEDVRKDKKIADADLSRKESPKGKKDREKEKVDLEKSAKTKENRKKSTNMKDVSSKMASRDKDDRKESRSSTRYAHLTKGNTQKRNG
Protein accession: NP_115856.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000444-B02P-13-15-1.jpg
Application image note: Western Blot analysis of ASPH expression in transfected 293T cell line (H00000444-T02) by ASPH MaxPab polyclonal antibody.

Lane 1: ASPH transfected lysate(23.1 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ASPH purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart