Brand: | Abnova |
Reference: | H00000440-M02 |
Product name: | ASNS monoclonal antibody (M02), clone 2B3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ASNS. |
Clone: | 2B3 |
Isotype: | IgG1 Kappa |
Gene id: | 440 |
Gene name: | ASNS |
Gene alias: | TS11 |
Gene description: | asparagine synthetase |
Genbank accession: | BC014621 |
Immunogen: | ASNS (AAH14621, 281 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKA |
Protein accession: | AAH14621 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of ASNS transfected lysate using anti-ASNS monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ASNS MaxPab rabbit polyclonal antibody. |
Applications: | ELISA,IP |
Shipping condition: | Dry Ice |