Brand: | Abnova |
Reference: | H00000429-M02 |
Product name: | ASCL1 monoclonal antibody (M02), clone 2D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ASCL1. |
Clone: | 2D9 |
Isotype: | IgG2b Kappa |
Gene id: | 429 |
Gene name: | ASCL1 |
Gene alias: | ASH1|HASH1|MASH1|bHLHa46 |
Gene description: | achaete-scute complex homolog 1 (Drosophila) |
Genbank accession: | NM_004316 |
Immunogen: | ASCL1 (NP_004307, 137 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF |
Protein accession: | NP_004307 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged ASCL1 is approximately 10ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |