ARSB monoclonal antibody (M10), clone 2G6 View larger

ARSB monoclonal antibody (M10), clone 2G6

H00000411-M10_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARSB monoclonal antibody (M10), clone 2G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ARSB monoclonal antibody (M10), clone 2G6

Brand: Abnova
Reference: H00000411-M10
Product name: ARSB monoclonal antibody (M10), clone 2G6
Product description: Mouse monoclonal antibody raised against a partial recombinant ARSB.
Clone: 2G6
Isotype: IgG1 Kappa
Gene id: 411
Gene name: ARSB
Gene alias: ASB|G4S|MPS6
Gene description: arylsulfatase B
Genbank accession: NM_198709
Immunogen: ARSB (NP_942002, 166 a.a. ~ 265 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHH
Protein accession: NP_942002
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000411-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000411-M10-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ARSB is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ARSB monoclonal antibody (M10), clone 2G6 now

Add to cart