ARNT monoclonal antibody (M02), clone 1F12 View larger

ARNT monoclonal antibody (M02), clone 1F12

H00000405-M02_50ug

New product

395,00 € tax excl.

50 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARNT monoclonal antibody (M02), clone 1F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ARNT monoclonal antibody (M02), clone 1F12

Brand: Abnova
Reference: H00000405-M02
Product name: ARNT monoclonal antibody (M02), clone 1F12
Product description: Mouse monoclonal antibody raised against a partial recombinant ARNT.
Clone: 1F12
Isotype: IgG1 Kappa
Gene id: 405
Gene name: ARNT
Gene alias: HIF-1beta|HIF1B|HIF1BETA|TANGO|bHLHe2
Gene description: aryl hydrocarbon receptor nuclear translocator
Genbank accession: BC060838
Immunogen: ARNT (AAH60838, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYIT
Protein accession: AAH60838
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000405-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000405-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ARNT is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ARNT monoclonal antibody (M02), clone 1F12 now

Add to cart