ARL3 MaxPab mouse polyclonal antibody (B02) View larger

ARL3 MaxPab mouse polyclonal antibody (B02)

H00000403-B02_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARL3 MaxPab mouse polyclonal antibody (B02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about ARL3 MaxPab mouse polyclonal antibody (B02)

Brand: Abnova
Reference: H00000403-B02
Product name: ARL3 MaxPab mouse polyclonal antibody (B02)
Product description: Mouse polyclonal antibody raised against a full-length human ARL3 protein.
Gene id: 403
Gene name: ARL3
Gene alias: ARFL3
Gene description: ADP-ribosylation factor-like 3
Genbank accession: NM_004311
Immunogen: ARL3 (NP_004302, 1 a.a. ~ 182 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK
Protein accession: NP_004302
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000403-B02-13-15-1.jpg
Application image note: Western Blot analysis of ARL3 expression in transfected 293T cell line (H00000403-T02) by ARL3 MaxPab polyclonal antibody.

Lane 1: ARL3 transfected lysate(20.02 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ARL3 MaxPab mouse polyclonal antibody (B02) now

Add to cart