Brand: | Abnova |
Reference: | H00000398-A01 |
Product name: | ARHGDIG polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant ARHGDIG. |
Gene id: | 398 |
Gene name: | ARHGDIG |
Gene alias: | RHOGDI-3 |
Gene description: | Rho GDP dissociation inhibitor (GDI) gamma |
Genbank accession: | BC047699 |
Immunogen: | ARHGDIG (AAH47699, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWKD |
Protein accession: | AAH47699 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (50.86 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ARHGDIG polyclonal antibody (A01), Lot # 050921JC01 Western Blot analysis of ARHGDIG expression in 293 ( Cat # L026V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |