Brand: | Abnova |
Reference: | H00000397-M01 |
Product name: | ARHGDIB monoclonal antibody (M01), clone 2C12-B6 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ARHGDIB. |
Clone: | 2C12-B6 |
Isotype: | IgG1 kappa |
Gene id: | 397 |
Gene name: | ARHGDIB |
Gene alias: | D4|GDIA2|GDID4|LYGDI|Ly-GDI|RAP1GN1|RhoGDI2 |
Gene description: | Rho GDP dissociation inhibitor (GDI) beta |
Genbank accession: | BC009200 |
Immunogen: | ARHGDIB (AAH09200, 1 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE |
Protein accession: | AAH09200 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ARHGDIB is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |