No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Rabbit |
Applications | WB-Ce,WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00000397-D01P |
Product name: | ARHGDIB purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human ARHGDIB protein. |
Gene id: | 397 |
Gene name: | ARHGDIB |
Gene alias: | D4|GDIA2|GDID4|LYGDI|Ly-GDI|RAP1GN1|RhoGDI2 |
Gene description: | Rho GDP dissociation inhibitor (GDI) beta |
Genbank accession: | NM_001175 |
Immunogen: | ARHGDIB (NP_001166.3, 1 a.a. ~ 201 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE |
Protein accession: | NP_001166.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | Western Blot analysis of ARHGDIB expression in transfected 293T cell line (H00000397-T01) by ARHGDIB MaxPab polyclonal antibody. Lane 1: ARHGDIB transfected lysate(23.00 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |