Cart 117 Product Products 29 181,61 € (empty)
-
1 x PKM2...259,07 € -
1 x ICK...259,07 € -
1 x PBF...259,07 € -
1 x DDR1...259,07 € -
1 x FAK...259,07 € -
1 x FOP...259,07 € -
1 x IκB-β...259,07 € -
-
1 x FAS...259,07 € -
1 x PML...259,07 € -
1 x POT1...259,07 € -
1 x THP...259,07 € -
-
1 x Donkey...339,00 € -
1 x FN1...259,07 € -
1 x Vav...259,07 € -
1 x FAK...259,07 € -
1 x MCM6...259,07 € -
1 x AZ1...259,07 € -
1 x VDR...259,07 € -
1 x CA I...259,07 € -
-
1 x PI-9...259,07 € -
1 x PKC ζ...259,07 € -
1 x PKR...259,07 € -
1 x AR...259,07 € -
1 x SMF...259,07 € -
1 x OAT...259,07 € -
1 x 3pK...259,07 € -
1 x FIR...259,07 € -
1 x CD3-ε...259,07 € -
1 x NuMA...259,07 € -
1 x Phospho-Fi...259,07 € -
1 x CD5...259,07 € -
1 x PTEN...259,07 € -
-
-
1 x Cbl...259,07 € -
1 x CD4...259,07 € -
1 x Fyb...259,07 € -
1 x PGLS...259,07 € -
1 x CD3-δ...259,07 € -
1 x PTN...259,07 € -
1 x FX...259,07 € -
1 x FAK...259,07 € -
1 x Flg...259,07 € -
1 x HIRA...259,07 € -
1 x Txk...259,07 € -
1 x CBP...259,07 € -
1 x FAK...259,07 € -
1 x G2A...259,07 € -
1 x PITPβ...259,07 € -
1 x Ub...259,07 € -
1 x PRC...259,07 € -
1 x IκB-α...259,07 € -
1 x PKC...259,07 € -
1 x GMF-β...259,07 € -
1 x NF2...259,07 € -
1 x NPY...259,07 € -
-
1 x PKC ζ...259,07 € -
1 x Phospho-Fl...259,07 € -
1 x EFP...259,07 € -
-
-
1 x Phospho-Ep...259,07 € -
1 x Phospho-MK...259,07 € -
1 x FAK...259,07 € -
1 x B23...259,07 € -
1 x Phospho-Tr...259,07 € -
-
1 x CBP...259,07 € -
1 x GCG...259,07 € -
1 x ZP1...259,07 € -
1 x VIP...259,07 € -
1 x Fer...259,07 € -
1 x PKC γ...259,07 € -
1 x SRY...259,07 € -
1 x VHL...259,07 € -
1 x ZP2...259,07 € -
1 x CAD...259,07 € -
1 x PRX1...259,07 € -
1 x FAS...259,07 € -
1 x NSF...259,07 € -
1 x Phospho-AM...259,07 € -
1 x Cbl...259,07 € -
1 x p53...259,07 € -
1 x Phospho-Fo...259,07 € -
1 x VCP...259,07 € -
-
1 x CD3-δ...259,07 € -
1 x CD9...259,07 € -
1 x FAK...259,07 € -
1 x PR...259,07 € -
1 x MAG...259,07 € -
1 x Phospho-NF...259,07 € -
1 x NT-4...259,07 € -
1 x WIP...259,07 € -
1 x IκB-ε...259,07 € -
-
1 x Cbl...259,07 € -
1 x Fer...259,07 € -
1 x GCK...259,07 € -
1 x ALR...259,07 € -
-
1 x Phospho-ER...259,07 € -
1 x Cdk2...259,07 € -
1 x FAK...259,07 € -
1 x PRPH...259,07 € -
1 x Ub...259,07 € -
-
1 x Cdc6...259,07 € -
1 x Fnk...259,07 € -
1 x GAK...259,07 € -
1 x p53...259,07 € -
-
-
No products
To be determined Shipping
29 181,61 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 117 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 29 181,61 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 29 181,61 €
Data sheet of ARHGDIA purified MaxPab rabbit polyclonal antibody (D03P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Ti,WB-Tr |
More info about ARHGDIA purified MaxPab rabbit polyclonal antibody (D03P)
| Brand: | Abnova |
| Reference: | H00000396-D03P |
| Product name: | ARHGDIA purified MaxPab rabbit polyclonal antibody (D03P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human ARHGDIA protein. |
| Gene id: | 396 |
| Gene name: | ARHGDIA |
| Gene alias: | GDIA1|MGC117248|RHOGDI|RHOGDI-1 |
| Gene description: | Rho GDP dissociation inhibitor (GDI) alpha |
| Genbank accession: | BC016031 |
| Immunogen: | ARHGDIA (AAH16031.1, 1 a.a. ~ 204 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD |
| Protein accession: | AAH16031.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Western Blot analysis of ARHGDIA expression in transfected 293T cell line (H00000396-T03) by ARHGDIA MaxPab polyclonal antibody. Lane 1: ARHGDIA transfected lysate(22.55 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |