ARHGDIA purified MaxPab rabbit polyclonal antibody (D01P) View larger

ARHGDIA purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARHGDIA purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about ARHGDIA purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00000396-D01P
Product name: ARHGDIA purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human ARHGDIA protein.
Gene id: 396
Gene name: ARHGDIA
Gene alias: GDIA1|MGC117248|RHOGDI|RHOGDI-1
Gene description: Rho GDP dissociation inhibitor (GDI) alpha
Genbank accession: NM_004309
Immunogen: ARHGDIA (NP_004300.1, 1 a.a. ~ 204 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Protein accession: NP_004300.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00000396-D01P-13-15-1.jpg
Application image note: Western Blot analysis of ARHGDIA expression in transfected 293T cell line (H00000396-T02) by ARHGDIA MaxPab polyclonal antibody.

Lane 1: ARHGDIA transfected lysate(23.20 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ARHGDIA purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart