Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RHOC polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about RHOC polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00000389-A01 |
| Product name: | RHOC polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant RHOC. |
| Gene id: | 389 |
| Gene name: | RHOC |
| Gene alias: | ARH9|ARHC|H9|MGC1448|MGC61427|RHOH9 |
| Gene description: | ras homolog gene family, member C |
| Genbank accession: | NM_175744 |
| Immunogen: | RHOC (NP_786886, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGC |
| Protein accession: | NP_786886 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | RhoB/ROCK mediates oxygen-glucose deprivation-stimulated syncytiotrophoblast microparticle shedding in preeclampsia.Han J, Yang BP, Li YL, Li HM, Zheng XH, Yu LL, Zhang Q, Zheng YR, Yi P, Li L, Guo JX, Zhou YG. Cell Tissue Res. 2016 Jun 21. |