Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00000387-M07 |
Product name: | RHOA monoclonal antibody (M07), clone 1C11 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant RHOA. |
Clone: | 1C11 |
Isotype: | IgG1 Lambda |
Gene id: | 387 |
Gene name: | RHOA |
Gene alias: | ARH12|ARHA|RHO12|RHOH12 |
Gene description: | ras homolog gene family, member A |
Genbank accession: | BC001360 |
Immunogen: | RHOA (AAH01360, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL |
Protein accession: | AAH01360 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (46.97 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of RHOA expression in transfected 293T cell line by RHOA monoclonal antibody (M07), clone 1C11. Lane 1: RHOA transfected lysate(21.8 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |