Brand: | Abnova |
Reference: | H00000387-M06 |
Product name: | RHOA monoclonal antibody (M06), clone 1C10 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant RHOA. |
Clone: | 1C10 |
Isotype: | IgG1 lambda |
Gene id: | 387 |
Gene name: | RHOA |
Gene alias: | ARH12|ARHA|RHO12|RHOH12 |
Gene description: | ras homolog gene family, member A |
Genbank accession: | BC001360 |
Immunogen: | RHOA (AAH01360, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL |
Protein accession: | AAH01360 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (46.97 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RHOA monoclonal antibody (M06), clone 1C10 Western Blot analysis of RHOA expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |