RHOA monoclonal antibody (M04), clone 1B12 View larger

RHOA monoclonal antibody (M04), clone 1B12

H00000387-M04_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RHOA monoclonal antibody (M04), clone 1B12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about RHOA monoclonal antibody (M04), clone 1B12

Brand: Abnova
Reference: H00000387-M04
Product name: RHOA monoclonal antibody (M04), clone 1B12
Product description: Mouse monoclonal antibody raised against a full length recombinant RHOA.
Clone: 1B12
Isotype: IgG1 lambda
Gene id: 387
Gene name: RHOA
Gene alias: ARH12|ARHA|RHO12|RHOH12
Gene description: ras homolog gene family, member A
Genbank accession: BC001360
Immunogen: RHOA (AAH01360, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Protein accession: AAH01360
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000387-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (46.97 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000387-M04-3-22-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to RHOA on formalin-fixed paraffin-embedded human lymphoma tissue.[antibody concentration 5 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Relationship of RhoA signaling activity with ezrin expression and its significance in the prognosis for breast cancer patients.Ma L, Liu YP, Zhang XH, Geng CZ, Li ZH.
Chin Med J (Engl). 2013 Jan;126(2):242-7.

Reviews

Buy RHOA monoclonal antibody (M04), clone 1B12 now

Add to cart