Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ARF6 monoclonal antibody (M01A), clone 2A4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about ARF6 monoclonal antibody (M01A), clone 2A4
| Brand: | Abnova |
| Reference: | H00000382-M01A |
| Product name: | ARF6 monoclonal antibody (M01A), clone 2A4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ARF6. |
| Clone: | 2A4 |
| Isotype: | IgM kappa |
| Gene id: | 382 |
| Gene name: | ARF6 |
| Gene alias: | DKFZp564M0264 |
| Gene description: | ADP-ribosylation factor 6 |
| Genbank accession: | BC008918 |
| Immunogen: | ARF6 (AAH08918, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS |
| Protein accession: | AAH08918 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (44.99 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ARF6 expression in transfected 293T cell line by ARF6 monoclonal antibody (M01A), clone 2A4. Lane 1: ARF6 transfected lysate (Predicted MW: 20.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |