Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ARF5 monoclonal antibody (M01), clone 1B4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about ARF5 monoclonal antibody (M01), clone 1B4
| Brand: | Abnova |
| Reference: | H00000381-M01 |
| Product name: | ARF5 monoclonal antibody (M01), clone 1B4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ARF5. |
| Clone: | 1B4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 381 |
| Gene name: | ARF5 |
| Gene alias: | - |
| Gene description: | ADP-ribosylation factor 5 |
| Genbank accession: | BC003043 |
| Immunogen: | ARF5 (AAH03043, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR |
| Protein accession: | AAH03043 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | ARF5 monoclonal antibody (M01), clone 1B4 Western Blot analysis of ARF5 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Class I Arfs (Arf1 and Arf3) and Arf6 are localized to the Flemming body and play important roles in cytokinesis.Hanai A, Ohgi M, Yagi C, Ueda T, Shin HW, Nakayama K. J Biochem. 2015 Sep 1.[Epub ahead of print] |