ARL4D purified MaxPab mouse polyclonal antibody (B01P) View larger

ARL4D purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARL4D purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ARL4D purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00000379-B01P
Product name: ARL4D purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ARL4D protein.
Gene id: 379
Gene name: ARL4D
Gene alias: ARF4L|ARL6
Gene description: ADP-ribosylation factor-like 4D
Genbank accession: NM_001661
Immunogen: ARL4D (NP_001652.2, 1 a.a. ~ 201 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR
Protein accession: NP_001652.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000379-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ARL4D expression in transfected 293T cell line (H00000379-T01) by ARL4D MaxPab polyclonal antibody.

Lane 1: ARL4D transfected lysate(22.11 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ARL4D purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart