ABCC6 monoclonal antibody (M01), clone 1E6 View larger

ABCC6 monoclonal antibody (M01), clone 1E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ABCC6 monoclonal antibody (M01), clone 1E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ABCC6 monoclonal antibody (M01), clone 1E6

Brand: Abnova
Reference: H00000368-M01
Product name: ABCC6 monoclonal antibody (M01), clone 1E6
Product description: Mouse monoclonal antibody raised against a partial recombinant ABCC6.
Clone: 1E6
Isotype: IgG2b Kappa
Gene id: 368
Gene name: ABCC6
Gene alias: ABC34|ARA|EST349056|MLP1|MOATE|MRP6|PXE|PXE1
Gene description: ATP-binding cassette, sub-family C (CFTR/MRP), member 6
Genbank accession: NM_001171
Immunogen: ABCC6 (NP_001162, 831 a.a. ~ 930 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IAEMGSYQELLQRKGALVCLLDQARQPGDRGEGETEPGTSTKDPRGTSAGRRPELRRERSIKSVPEKDRTTSEAQTEVPLDDPDRAGWPAGKDSIQYGRV
Protein accession: NP_001162
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00000368-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00000368-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ABCC6 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ABCC6 monoclonal antibody (M01), clone 1E6 now

Add to cart