KLK3 purified MaxPab rabbit polyclonal antibody (D01P) View larger

KLK3 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLK3 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,PLA-Ce

More info about KLK3 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00000354-D01P
Product name: KLK3 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human KLK3 protein.
Gene id: 354
Gene name: KLK3
Gene alias: APS|KLK2A1|PSA|hK3
Gene description: kallikrein-related peptidase 3
Genbank accession: NM_001648
Immunogen: KLK3 (NP_001639.1, 1 a.a. ~ 261 a.a) full-length human protein.
Immunogen sequence/protein sequence: MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Protein accession: NP_001639.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00000354-D01P-13-15-1.jpg
Application image note: Western Blot analysis of KLK3 expression in transfected 293T cell line (H00000354-T01) by KLK3 MaxPab polyclonal antibody.

Lane 1: KLK3 transfected lysate(28.70 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy KLK3 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart