Brand: | Abnova |
Reference: | H00000350-M04A |
Product name: | APOH monoclonal antibody (M04A), clone 2F12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant APOH. |
Clone: | 2F12 |
Isotype: | IgG1 Kappa |
Gene id: | 350 |
Gene name: | APOH |
Gene alias: | B2G1|BG |
Gene description: | apolipoprotein H (beta-2-glycoprotein I) |
Genbank accession: | NM_000042 |
Immunogen: | APOH (NP_000033, 236 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC |
Protein accession: | NP_000033 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |